Lineage for d4bnoc_ (4bno C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146886Species Plasmodium falciparum [TaxId:36329] [187826] (16 PDB entries)
  8. 2146922Domain d4bnoc_: 4bno C: [307061]
    automated match to d2i7ca_
    complexed with 1pg, 4zy, gol, mta

Details for d4bnoc_

PDB Entry: 4bno (more details), 2.05 Å

PDB Description: Crystal Structure of Plasmodium Falciparum Spermidine Synthase in Complex with 5'-Deoxy-5'-Methylioadenosine and 4-Aminomethyl aniline
PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d4bnoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bnoc_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d4bnoc_:

Click to download the PDB-style file with coordinates for d4bnoc_.
(The format of our PDB-style files is described here.)

Timeline for d4bnoc_: