Lineage for d4bgta4 (4bgt A:145-309)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557460Species Chloroflexus aurantiacus [TaxId:1108] [311361] (1 PDB entry)
  8. 2557461Domain d4bgta4: 4bgt A:145-309 [307048]
    Other proteins in same PDB: d4bgta3, d4bgtd3
    automated match to d4rora2
    complexed with act, cd, cl, peg

Details for d4bgta4

PDB Entry: 4bgt (more details), 1.7 Å

PDB Description: 1.70 A resolution structure of the malate dehydrogenase from Chloroflexus aurantiacus
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4bgta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgta4 d.162.1.0 (A:145-309) automated matches {Chloroflexus aurantiacus [TaxId: 1108]}
gvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrlaq
ivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndiy
fgvpvilgaggvekilelplneeemallnasakavratldtlksl

SCOPe Domain Coordinates for d4bgta4:

Click to download the PDB-style file with coordinates for d4bgta4.
(The format of our PDB-style files is described here.)

Timeline for d4bgta4:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bgta3