Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Chloroflexus aurantiacus [TaxId:1108] [311360] (1 PDB entry) |
Domain d4bgta3: 4bgt A:1-144 [307047] Other proteins in same PDB: d4bgta4, d4bgtd4 automated match to d4rora1 complexed with act, cd, cl, peg |
PDB Entry: 4bgt (more details), 1.7 Å
SCOPe Domain Sequences for d4bgta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgta3 c.2.1.0 (A:1-144) automated matches {Chloroflexus aurantiacus [TaxId: 1108]} mrkkisiigagfvgsttahwlaakelgdivlldfvegvpqgkaldlyeaspiegfdvrvt gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn pldamtylaaevsgfpkervigqa
Timeline for d4bgta3: