SCOPe 2.08: Domain d4bgta3: 4bgt A:1-144

Lineage for d4bgta3 (4bgt A:1-144)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Chloroflexus aurantiacus [TaxId:1108] [311360] (1 PDB entry)

8. Domain d4bgta3: 4bgt A:1-144 [307047]
   Other proteins in same PDB: d4bgta4, d4bgtd4
   automated match to d4rora1
   complexed with act, cd, cl, peg

Details for d4bgta3

PDB Entry: 4bgt, 1.7 Å

PDB Description: 1.70 A resolution structure of the malate dehydrogenase from Chloroflexus aurantiacus

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4bgta3:

Sequence; same for both SEQRES and ATOM records:

>d4bgta3 c.2.1.0 (A:1-144) automated matches {Chloroflexus aurantiacus [TaxId: 1108]}
mrkkisiigagfvgsttahwlaakelgdivlldfvegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
pldamtylaaevsgfpkervigqa

Timeline for d4bgta3:

• d4bgta3 first appeared in SCOPe 2.06
  
• d4bgta3 appears in SCOPe 2.07