Lineage for d2dika2 (2dik A:377-505)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21275Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 21276Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 21277Protein Pyruvate phosphate dikinase, central domain [52011] (1 species)
  7. 21278Species Clostridium symbiosum [TaxId:1512] [52012] (3 PDB entries)
  8. 21281Domain d2dika2: 2dik A:377-505 [30704]
    Other proteins in same PDB: d2dika1, d2dika3

Details for d2dika2

PDB Entry: 2dik (more details), 2.5 Å

PDB Description: r337a mutant of pyruvate phosphate dikinase

SCOP Domain Sequences for d2dika2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dika2 c.8.1.1 (A:377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgki

SCOP Domain Coordinates for d2dika2:

Click to download the PDB-style file with coordinates for d2dika2.
(The format of our PDB-style files is described here.)

Timeline for d2dika2: