Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species Aura virus [TaxId:44158] [194195] (5 PDB entries) |
Domain d4ausb_: 4aus B: [307033] Other proteins in same PDB: d4ausa2 automated match to d1kxfa_ complexed with gol |
PDB Entry: 4aus (more details), 1.81 Å
SCOPe Domain Sequences for d4ausb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ausb_ b.47.1.3 (B:) automated matches {Aura virus [TaxId: 44158]} alkfeadrtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmef aklptemksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkv vaivlgganegartalsvvtwnkkgaaiktth
Timeline for d4ausb_: