Lineage for d4ausb_ (4aus B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797157Protein automated matches [190658] (12 species)
    not a true protein
  7. 2797158Species Aura virus [TaxId:44158] [194195] (5 PDB entries)
  8. 2797163Domain d4ausb_: 4aus B: [307033]
    Other proteins in same PDB: d4ausa2
    automated match to d1kxfa_
    complexed with gol

Details for d4ausb_

PDB Entry: 4aus (more details), 1.81 Å

PDB Description: Crystal structure of C-terminal truncated (110-265) Aura virus capsid protease.
PDB Compounds: (B:) capsid protein

SCOPe Domain Sequences for d4ausb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ausb_ b.47.1.3 (B:) automated matches {Aura virus [TaxId: 44158]}
alkfeadrtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmef
aklptemksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkv
vaivlgganegartalsvvtwnkkgaaiktth

SCOPe Domain Coordinates for d4ausb_:

Click to download the PDB-style file with coordinates for d4ausb_.
(The format of our PDB-style files is described here.)

Timeline for d4ausb_: