SCOPe 2.08: Domain d4ashb1: 4ash B:1-183

Lineage for d4ashb1 (4ash B:1-183)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries)

8. Domain d4ashb1: 4ash B:1-183 [307029]
   Other proteins in same PDB: d4asha2, d4ashb2
   automated match to d2fyqa_

Details for d4ashb1

PDB Entry: 4ash, 1.58 Å

PDB Description: Crystal structure of the NS6 protease from murine norovirus 1

PDB Compounds: (B:) ns6 protease

SCOPe Domain Sequences for d4ashb1:

Sequence, based on SEQRES records:

>d4ashb1 b.47.1.4 (B:1-183) automated matches {Murine norovirus 1 [TaxId: 223997]}
apvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyf
tsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgm
lltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptleal
efq

Sequence, based on observed residues (ATOM records):

>d4ashb1 b.47.1.4 (B:1-183) automated matches {Murine norovirus 1 [TaxId: 223997]}
apvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyf
tsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgm
lltlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlealefq

Timeline for d4ashb1:

• d4ashb1 first appeared in SCOPe 2.06
  
• d4ashb1 appears in SCOPe 2.07