Lineage for d1dik_2 (1dik 377-505)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577177Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
    contains barrel, closed, n=7, S=10
  5. 577178Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 577179Protein Pyruvate phosphate dikinase, central domain [52011] (2 species)
  7. 577180Species Clostridium symbiosum [TaxId:1512] [52012] (6 PDB entries)
  8. 577183Domain d1dik_2: 1dik 377-505 [30702]
    Other proteins in same PDB: d1dik_1, d1dik_3
    complexed with so4

Details for d1dik_2

PDB Entry: 1dik (more details), 2.3 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1dik_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dik_2 c.8.1.1 (377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgki

SCOP Domain Coordinates for d1dik_2:

Click to download the PDB-style file with coordinates for d1dik_2.
(The format of our PDB-style files is described here.)

Timeline for d1dik_2: