Lineage for d1b8ba_ (1b8b A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119528Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
  4. 119529Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (3 families) (S)
  5. 119566Family c.7.1.3: Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit [52005] (1 protein)
  6. 119567Protein Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit [52006] (1 species)
  7. 119568Species Bacteriophage T4 [TaxId:10665] [52007] (1 PDB entry)
  8. 119569Domain d1b8ba_: 1b8b A: [30701]

Details for d1b8ba_

PDB Entry: 1b8b (more details), 2.75 Å

PDB Description: class iii anaerobic ribonucleotide triphosphate reductase nrdd subunit, from bacteriophage t4

SCOP Domain Sequences for d1b8ba_:

Sequence, based on SEQRES records: (download)

>d1b8ba_ c.7.1.3 (A:) Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit {Bacteriophage T4}
srvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlkg
mlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtyak
hiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtltfgtgtdwt
ermiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrmy
pdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlprialds
yigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpdddi
ielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpae
nlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghis
yvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcftcgsthemtptengfvcsicge
tdpkkmntirrtcaylgnpnerg

Sequence, based on observed residues (ATOM records): (download)

>d1b8ba_ c.7.1.3 (A:) Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit {Bacteriophage T4}
srvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlkg
mlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtyak
hiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtltfgtgtdwt
ermiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrmy
pdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlprialds
yigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpdddi
ielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpae
nlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghis
yvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcntirrtcaylgnpnerg

SCOP Domain Coordinates for d1b8ba_:

Click to download the PDB-style file with coordinates for d1b8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ba_: