SCOPe 2.08: Domain d3x3fl2: 3x3f L:107-214

Lineage for d3x3fl2 (3x3f L:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3x3fl2: 3x3f L:107-214 [306971]
   Other proteins in same PDB: d3x3fa1, d3x3fa2, d3x3fh_, d3x3fl1
   automated match to d1dn0a2
   complexed with cl, gol, nag

Details for d3x3fl2

PDB Entry: 3x3f, 2.1 Å

PDB Description: trail-r2 extracellular region complexed to a fab fragment from human agonist antibody kmtr2

PDB Compounds: (L:) Light chain of KMTR2

SCOPe Domain Sequences for d3x3fl2:

Sequence; same for both SEQRES and ATOM records:

>d3x3fl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d3x3fl2:

• d3x3fl2 first appeared in SCOPe 2.06
  
• d3x3fl2 appears in SCOPe 2.07