Lineage for d3wtng1 (3wtn G:2-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819669Domain d3wtng1: 3wtn G:2-205 [306907]
    Other proteins in same PDB: d3wtna2, d3wtnb2, d3wtnc2, d3wtnd2, d3wtne2, d3wtnf2, d3wtng2, d3wtnh2, d3wtni2, d3wtnj2
    automated match to d2zjub_
    complexed with cd, n2y, na

Details for d3wtng1

PDB Entry: 3wtn (more details), 2.09 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with Desnitro-imidacloprid
PDB Compounds: (G:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtng1 b.96.1.1 (G:2-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3wtng1:

Click to download the PDB-style file with coordinates for d3wtng1.
(The format of our PDB-style files is described here.)

Timeline for d3wtng1: