SCOPe 2.08: Domain d3wthc1: 3wth C:2-207

Lineage for d3wthc1 (3wth C:2-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d3wthc1: 3wth C:2-207 [306839]
   Other proteins in same PDB: d3wtha2, d3wthb2, d3wthc2, d3wthd2, d3wthe2
   automated match to d2zjub_
   complexed with im4; mutant

Details for d3wthc1

PDB Entry: 3wth, 2.54 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein Q55R Mutant Complexed with Imidacloprid

PDB Compounds: (C:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wthc1:

Sequence; same for both SEQRES and ATOM records:

>d3wthc1 b.96.1.1 (C:2-207) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqrttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgrs

Timeline for d3wthc1:

• d3wthc1 first appeared in SCOPe 2.06
  
• d3wthc1 appears in SCOPe 2.07