Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
Protein automated matches [227123] (7 species) not a true protein |
Species Pyrococcus kodakaraensis [TaxId:69014] [226763] (2 PDB entries) |
Domain d3wqpc2: 3wqp C:136-444 [306814] Other proteins in same PDB: d3wqpa1, d3wqpb1, d3wqpc1, d3wqpd1, d3wqpe1, d3wqpf1, d3wqpg1, d3wqph1, d3wqpi1, d3wqpj1 automated match to d3a13a2 complexed with cap, edo, mg; mutant |
PDB Entry: 3wqp (more details), 2.25 Å
SCOPe Domain Sequences for d3wqpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wqpc2 c.1.14.0 (C:136-444) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]} fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd vvitgwgalryirdlaadyglaihghramhaafdrnpyhgismfvlaklyrligidqlhv gtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgni qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral ekwghvtpv
Timeline for d3wqpc2: