Lineage for d3wmo1_ (3wmo 1:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3021764Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)
  8. 3021861Domain d3wmo1_: 3wmo 1: [306780]
    Other proteins in same PDB: d3wmoc_, d3wmoh1, d3wmoh2, d3wmom_
    automated match to d1xrda1
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmo1_

PDB Entry: 3wmo (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (1:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmo1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmo1_ f.3.1.0 (1:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
lykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk

SCOPe Domain Coordinates for d3wmo1_:

Click to download the PDB-style file with coordinates for d3wmo1_.
(The format of our PDB-style files is described here.)

Timeline for d3wmo1_: