Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries) |
Domain d3wmo1_: 3wmo 1: [306780] Other proteins in same PDB: d3wmoc_, d3wmoh1, d3wmoh2, d3wmom_ automated match to d1xrda1 complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8 |
PDB Entry: 3wmo (more details), 3.01 Å
SCOPe Domain Sequences for d3wmo1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmo1_ f.3.1.0 (1:) automated matches {Thermochromatium tepidum [TaxId: 1050]} lykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
Timeline for d3wmo1_:
View in 3D Domains from other chains: (mouse over for more information) d3wmo0_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmoc_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_ |