Lineage for d3wena2 (3wen A:300-672)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095223Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2095227Protein Maltase, catalytic domain [310751] (1 species)
  7. 2095228Species Beta vulgaris [TaxId:161934] [311006] (6 PDB entries)
  8. 2095233Domain d3wena2: 3wen A:300-672 [306742]
    Other proteins in same PDB: d3wena1, d3wena3, d3wena4
    automated match to d3w38a2
    complexed with nag, so4

Details for d3wena2

PDB Entry: 3wen (more details), 2.59 Å

PDB Description: sugar beet alpha-glucosidase with acarviosyl-maltopentaose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3wena2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wena2 c.1.8.13 (A:300-672) Maltase, catalytic domain {Beta vulgaris [TaxId: 161934]}
pemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdid
ymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvf
ikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfits
aptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatreal
vrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadic
gfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpy
yytlmydanlrgi

SCOPe Domain Coordinates for d3wena2:

Click to download the PDB-style file with coordinates for d3wena2.
(The format of our PDB-style files is described here.)

Timeline for d3wena2: