Lineage for d3wema3 (3wem A:673-756)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077411Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)
  6. 2077412Protein Maltase, domain 3 [310753] (1 species)
  7. 2077413Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries)
  8. 2077417Domain d3wema3: 3wem A:673-756 [306739]
    Other proteins in same PDB: d3wema1, d3wema2, d3wema4
    automated match to d3w38a3
    complexed with nag, so4

Details for d3wema3

PDB Entry: 3wem (more details), 2.59 Å

PDB Description: sugar beet alpha-glucosidase with acarviosyl-maltotetraose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3wema3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wema3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]}
piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss
vsvsagtyvslsappdhinvhihe

SCOPe Domain Coordinates for d3wema3:

Click to download the PDB-style file with coordinates for d3wema3.
(The format of our PDB-style files is described here.)

Timeline for d3wema3: