Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (11 species) not a true protein |
Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries) |
Domain d3vr6d1: 3vr6 D:4-75 [306706] Other proteins in same PDB: d3vr6d2, d3vr6d3, d3vr6e2, d3vr6e3, d3vr6f2, d3vr6f3, d3vr6g1, d3vr6g2 automated match to d3gqbb1 complexed with anp, mg |
PDB Entry: 3vr6 (more details), 2.68 Å
SCOPe Domain Sequences for d3vr6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr6d1 b.49.1.0 (D:4-75) automated matches {Enterococcus hirae [TaxId: 1354]} eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi nlknssvrflgh
Timeline for d3vr6d1: