SCOPe 2.06: Domain d3vr2e1: 3vr2 E:2-75

Lineage for d3vr2e1 (3vr2 E:2-75)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries)

8. Domain d3vr2e1: 3vr2 E:2-75 [306690]
   Other proteins in same PDB: d3vr2d2, d3vr2d3, d3vr2e2, d3vr2e3, d3vr2f2, d3vr2f3
   automated match to d3gqbb1

Details for d3vr2e1

PDB Entry: 3vr2, 2.8 Å

PDB Description: Crystal structure of nucleotide-free A3B3 complex from Enterococcus hirae V-ATPase [eA3B3]

PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr2e1:

Sequence; same for both SEQRES and ATOM records:

>d3vr2e1 b.49.1.0 (E:2-75) automated matches {Enterococcus hirae [TaxId: 1354]}
ikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegts
ginlknssvrflgh

Timeline for d3vr2e1:

• d3vr2e1 is new in SCOPe 2.06-stable
  
• d3vr2e1 appears in SCOPe 2.07
  
• d3vr2e1 appears in the current release, SCOPe 2.08