Lineage for d3uh9b_ (3uh9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942883Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)
  8. 2942885Domain d3uh9b_: 3uh9 B: [306659]
    Other proteins in same PDB: d3uh9a2
    automated match to d4jd1b_
    complexed with edo, fcn, zn

Details for d3uh9b_

PDB Entry: 3uh9 (more details), 1.6 Å

PDB Description: Crystal Structure of Metallothiol Transferase FosB 2 from Bacillus anthracis str. Ames
PDB Compounds: (B:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d3uh9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uh9b_ d.32.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkh

SCOPe Domain Coordinates for d3uh9b_:

Click to download the PDB-style file with coordinates for d3uh9b_.
(The format of our PDB-style files is described here.)

Timeline for d3uh9b_: