Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries) |
Domain d3uh9b_: 3uh9 B: [306659] Other proteins in same PDB: d3uh9a2 automated match to d4jd1b_ complexed with edo, fcn, zn |
PDB Entry: 3uh9 (more details), 1.6 Å
SCOPe Domain Sequences for d3uh9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uh9b_ d.32.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]} mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt lqnrleyykedkkh
Timeline for d3uh9b_: