Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries) |
Domain d3u1zb1: 3u1z B:237-606 [306624] Other proteins in same PDB: d3u1za2, d3u1zb2, d3u1zb3 automated match to d4eg8b1 protein/RNA complex; complexed with 43e, dms, gol, met, so4 |
PDB Entry: 3u1z (more details), 2.9 Å
SCOPe Domain Sequences for d3u1zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u1zb1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]} kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk nmiarlngel
Timeline for d3u1zb1: