SCOPe 2.06: Domain d3u1zb1: 3u1z B:237-606

Lineage for d3u1zb1 (3u1z B:237-606)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries)

8. Domain d3u1zb1: 3u1z B:237-606 [306624]
   Other proteins in same PDB: d3u1za2, d3u1zb2, d3u1zb3
   automated match to d4eg8b1
   protein/RNA complex; complexed with 43e, dms, gol, met, so4

Details for d3u1zb1

PDB Entry: 3u1z, 2.9 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1433

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1zb1:

Sequence; same for both SEQRES and ATOM records:

>d3u1zb1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl
lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
nmiarlngel

Timeline for d3u1zb1:

• d3u1zb1 is new in SCOPe 2.06-stable
  
• d3u1zb1 appears in SCOPe 2.07
  
• d3u1zb1 appears in the current release, SCOPe 2.08