Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
Domain d3tuna2: 3tun A:607-768 [306601] Other proteins in same PDB: d3tuna1, d3tunb3, d3tunb5 automated match to d4eg8b2 protein/RNA complex; complexed with c13, dms, gol, met |
PDB Entry: 3tun (more details), 2.55 Å
SCOPe Domain Sequences for d3tuna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tuna2 a.27.1.0 (A:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste
Timeline for d3tuna2: