SCOPe 2.08: Domain d3tiib1: 3tii B:2-76

Lineage for d3tiib1 (3tii B:2-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [310976] (3 PDB entries)

8. Domain d3tiib1: 3tii B:2-76 [306553]
   Other proteins in same PDB: d3tiia2, d3tiia3, d3tiib2, d3tiib3
   complexed with anp, mg

Details for d3tiib1

PDB Entry: 3tii, 2.5 Å

PDB Description: Tubulin tyrosine ligase

PDB Compounds: (B:) Ttl protein

SCOPe Domain Sequences for d3tiib1:

Sequence; same for both SEQRES and ATOM records:

>d3tiib1 c.30.1.9 (B:2-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
ytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepglvql
vnyyrgadklcrkas

Timeline for d3tiib1:

• d3tiib1 first appeared in SCOPe 2.06
  
• d3tiib1 appears in SCOPe 2.07