SCOPe 2.08: Domain d3rwsa1: 3rws A:1-158

Lineage for d3rwsa1 (3rws A:1-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (8 PDB entries)

8. Domain d3rwsa1: 3rws A:1-158 [306489]
   Other proteins in same PDB: d3rwsa2
   automated match to d4jhga_
   complexed with mli, na, zea

Details for d3rwsa1

PDB Entry: 3rws, 1.85 Å

PDB Description: Crystal Structure of Medicago truncatula Nodulin 13 (MtN13) in complex with trans-zeatin

PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d3rwsa1:

Sequence; same for both SEQRES and ATOM records:

>d3rwsa1 d.129.3.0 (A:1-158) automated matches {Medicago truncatula [TaxId: 3880]}
mgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtikkltfv
gdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivksttky
ytkgddielskdyleagierfegftkavesfllanpdy

Timeline for d3rwsa1:

• d3rwsa1 first appeared in SCOPe 2.06
  
• d3rwsa1 appears in SCOPe 2.07