Lineage for d3rw0b1 (3rw0 B:2001-2221)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023737Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 3023750Protein NavAb sodium channel [310744] (1 species)
  7. 3023751Species Arcobacter butzleri [TaxId:367737] [310997] (16 PDB entries)
  8. 3023762Domain d3rw0b1: 3rw0 B:2001-2221 [306487]
    Other proteins in same PDB: d3rw0a2, d3rw0b2
    automated match to d3rvza_
    complexed with px4

Details for d3rw0b1

PDB Entry: 3rw0 (more details), 2.95 Å

PDB Description: Crystal structure of the NavAb voltage-gated sodium channel (Met221Cys, 2.95 A)
PDB Compounds: (B:) Ion transport protein

SCOPe Domain Sequences for d3rw0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rw0b1 f.14.1.2 (B:2001-2221) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaiivdac

SCOPe Domain Coordinates for d3rw0b1:

Click to download the PDB-style file with coordinates for d3rw0b1.
(The format of our PDB-style files is described here.)

Timeline for d3rw0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rw0b2