Lineage for d3rw0a1 (3rw0 A:1001-1221)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577188Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 2577201Protein NavAb sodium channel [310744] (1 species)
  7. 2577202Species Arcobacter butzleri [TaxId:367737] [310997] (13 PDB entries)
  8. 2577207Domain d3rw0a1: 3rw0 A:1001-1221 [306485]
    Other proteins in same PDB: d3rw0a2, d3rw0b2
    automated match to d3rvza_
    complexed with px4

Details for d3rw0a1

PDB Entry: 3rw0 (more details), 2.95 Å

PDB Description: Crystal structure of the NavAb voltage-gated sodium channel (Met221Cys, 2.95 A)
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d3rw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rw0a1 f.14.1.2 (A:1001-1221) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaiivdac

SCOPe Domain Coordinates for d3rw0a1:

Click to download the PDB-style file with coordinates for d3rw0a1.
(The format of our PDB-style files is described here.)

Timeline for d3rw0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rw0a2