Lineage for d3rvya_ (3rvy A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577188Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 2577201Protein NavAb sodium channel [310744] (1 species)
  7. 2577202Species Arcobacter butzleri [TaxId:367737] [310997] (13 PDB entries)
  8. 2577203Domain d3rvya_: 3rvy A: [306481]
    automated match to d3rvza_
    complexed with px4

Details for d3rvya_

PDB Entry: 3rvy (more details), 2.7 Å

PDB Description: Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d3rvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvya_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam

SCOPe Domain Coordinates for d3rvya_:

Click to download the PDB-style file with coordinates for d3rvya_.
(The format of our PDB-style files is described here.)

Timeline for d3rvya_: