SCOPe 2.06: Domain d3rp0d_: 3rp0 D:

Lineage for d3rp0d_ (3rp0 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d3rp0d_: 3rp0 D: [306478]
   automated match to d3h30a_
   complexed with anp, mg, so4

Details for d3rp0d_

PDB Entry: 3rp0, 3 Å

PDB Description: Structure of human CK2alpha in complex with a non-hydrolysable ATP-analogue and magnesium ions

PDB Compounds: (D:) Casein kinase II subunit alpha, Casein kinase II subunit alpha'

SCOPe Domain Sequences for d3rp0d_:

Sequence; same for both SEQRES and ATOM records:

>d3rp0d_ d.144.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfypvvke

Timeline for d3rp0d_:

• d3rp0d_ is new in SCOPe 2.06-stable
  
• d3rp0d_ appears in SCOPe 2.07
  
• d3rp0d_ appears in the current release, SCOPe 2.08