Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein) This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold |
Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species) |
Species Rhodotorula gracilis [TaxId:5286] [51982] (4 PDB entries) |
Domain d1c0pa1: 1c0p A:1001-1193,A:1289-1361 [30647] Other proteins in same PDB: d1c0pa2, d1c0pa3 complexed with dal, fad, gol, per |
PDB Entry: 1c0p (more details), 1.2 Å
SCOPe Domain Sequences for d1c0pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0pa1 c.4.1.2 (A:1001-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} mhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpfmt ltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrplps secppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvnatg lgaksiagiddqaXrggprveaerivlpldrtksplslgrgsaraakekevtlvhaygfs sagyqqswgaaedvaqlvdeafqryhg
Timeline for d1c0pa1: