SCOPe 2.08: Domain d3ri2b1: 3ri2 B:1-111

Lineage for d3ri2b1 (3ri2 B:1-111)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries)

8. Domain d3ri2b1: 3ri2 B:1-111 [306462]
   Other proteins in same PDB: d3ri2a2, d3ri2b2
   automated match to d4ejob_

Details for d3ri2b1

PDB Entry: 3ri2, 2.1 Å

PDB Description: Crystal structure of PadR family transcriptional regulator from Eggerthella lenta DSM 2243

PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d3ri2b1:

Sequence, based on SEQRES records:

>d3ri2b1 a.4.5.0 (B:1-111) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle
sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletn

Sequence, based on observed residues (ATOM records):

>d3ri2b1 a.4.5.0 (B:1-111) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipintlyplmrrlesq
gllasewdnggkprkyyrttdeglrvlreveaqwhvlcdgvgklletn

Timeline for d3ri2b1:

• d3ri2b1 first appeared in SCOPe 2.06
  
• d3ri2b1 appears in SCOPe 2.07