Class b: All beta proteins [48724] (180 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (7 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226571] (2 PDB entries) |
Domain d3rfod2: 3rfo D:205-312 [306458] Other proteins in same PDB: d3rfoa1, d3rfoa3, d3rfob1, d3rfob3, d3rfoc1, d3rfoc3, d3rfod1, d3rfod3 automated match to d4iqfb2 complexed with gol, pge, so4 |
PDB Entry: 3rfo (more details), 2.4 Å
SCOPe Domain Sequences for d3rfod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rfod2 b.46.1.0 (D:205-312) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ikreqekidwtktgeevynhirglnpwpvayttlagqvvkvwwgekvpvtksaeagtiva ieedgfvvatgnetgvkitelqpsgkkrmscsqflrgtkpeigtklge
Timeline for d3rfod2: