Lineage for d3rfod2 (3rfo D:205-312)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794501Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2794502Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2794549Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2794550Protein automated matches [227053] (7 species)
    not a true protein
  7. 2794551Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226571] (2 PDB entries)
  8. 2794559Domain d3rfod2: 3rfo D:205-312 [306458]
    Other proteins in same PDB: d3rfoa1, d3rfoa3, d3rfob1, d3rfob3, d3rfoc1, d3rfoc3, d3rfod1, d3rfod3
    automated match to d4iqfb2
    complexed with gol, pge, so4

Details for d3rfod2

PDB Entry: 3rfo (more details), 2.4 Å

PDB Description: Crystal Structure of Methyionyl-tRNA Formyltransferase from Bacillus anthracis
PDB Compounds: (D:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3rfod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rfod2 b.46.1.0 (D:205-312) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ikreqekidwtktgeevynhirglnpwpvayttlagqvvkvwwgekvpvtksaeagtiva
ieedgfvvatgnetgvkitelqpsgkkrmscsqflrgtkpeigtklge

SCOPe Domain Coordinates for d3rfod2:

Click to download the PDB-style file with coordinates for d3rfod2.
(The format of our PDB-style files is described here.)

Timeline for d3rfod2: