Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
Protein automated matches [230465] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries) |
Domain d3rcac1: 3rca C:571-694 [306434] Other proteins in same PDB: d3rcaa1, d3rcaa2, d3rcab1, d3rcab2, d3rcac2, d3rcaj1, d3rcaj2, d3rcak1, d3rcak2, d3rcal2 automated match to d3b9jc1 complexed with fad, fes, mte, rmo |
PDB Entry: 3rca (more details), 2.1 Å
SCOPe Domain Sequences for d3rcac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rcac1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]} dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye dlpa
Timeline for d3rcac1: