Lineage for d3rcaa2 (3rca A:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715334Protein automated matches [232101] (1 species)
    not a true protein
  7. 2715335Species Cow (Bos taurus) [TaxId:9913] [232106] (10 PDB entries)
  8. 2715346Domain d3rcaa2: 3rca A:93-165 [306431]
    Other proteins in same PDB: d3rcaa1, d3rcab1, d3rcab2, d3rcac1, d3rcac2, d3rcaj1, d3rcak1, d3rcak2, d3rcal1, d3rcal2
    automated match to d1v97a1
    complexed with fad, fes, mte, rmo

Details for d3rcaa2

PDB Entry: 3rca (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Form of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3rcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rcaa2 a.56.1.1 (A:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3rcaa2:

Click to download the PDB-style file with coordinates for d3rcaa2.
(The format of our PDB-style files is described here.)

Timeline for d3rcaa2: