Lineage for d1daoe1 (1dao E:1-194,E:288-339)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309865Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 309866Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 309917Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
    This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold
  6. 309918Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)
  7. 309919Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 309938Domain d1daoe1: 1dao E:1-194,E:288-339 [30643]
    Other proteins in same PDB: d1daoa2, d1daob2, d1daoc2, d1daod2, d1daoe2, d1daof2, d1daog2, d1daoh2

Details for d1daoe1

PDB Entry: 1dao (more details), 3.2 Å

PDB Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid

SCOP Domain Sequences for d1daoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daoe1 c.4.1.2 (E:1-194,E:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOP Domain Coordinates for d1daoe1:

Click to download the PDB-style file with coordinates for d1daoe1.
(The format of our PDB-style files is described here.)

Timeline for d1daoe1: