Lineage for d3r4ec1 (3r4e C:1-111)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191982Species Novosphingobium aromaticivorans [TaxId:279238] [267958] (3 PDB entries)
  8. 2191990Domain d3r4ec1: 3r4e C:1-111 [306419]
    Other proteins in same PDB: d3r4ea2, d3r4ea3, d3r4eb2, d3r4ec2, d3r4ed2
    automated match to d4k8ga1
    complexed with cs2, mg; mutant

Details for d3r4ec1

PDB Entry: 3r4e (more details), 1.65 Å

PDB Description: Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with MG and D-mannonate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3r4ec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4ec1 d.54.1.0 (C:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

SCOPe Domain Coordinates for d3r4ec1:

Click to download the PDB-style file with coordinates for d3r4ec1.
(The format of our PDB-style files is described here.)

Timeline for d3r4ec1: