Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries) |
Domain d3qkfh2: 3qkf H:114-405 [306383] Other proteins in same PDB: d3qkfa1, d3qkfa3, d3qkfb1, d3qkfb3, d3qkfc1, d3qkfc3, d3qkfd1, d3qkfd3, d3qkfe1, d3qkfe3, d3qkff1, d3qkff3, d3qkfg1, d3qkfg3, d3qkfh1, d3qkfh3 automated match to d3thua2 complexed with gco, mg; mutant |
PDB Entry: 3qkf (more details), 1.45 Å
SCOPe Domain Sequences for d3qkfh2:
Sequence, based on SEQRES records: (download)
>d3qkfh2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d3qkfh2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvslpaehvwst ekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaen qeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlas lyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghfl agespghgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d3qkfh2: