Lineage for d3qkfc1 (3qkf C:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948060Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2948071Domain d3qkfc1: 3qkf C:4-113 [306367]
    Other proteins in same PDB: d3qkfa2, d3qkfa3, d3qkfb2, d3qkfb3, d3qkfc2, d3qkfc3, d3qkfd2, d3qkfd3, d3qkfe2, d3qkfe3, d3qkff2, d3qkff3, d3qkfg2, d3qkfg3, d3qkfh2, d3qkfh3
    automated match to d3thua1
    complexed with gco, mg; mutant

Details for d3qkfc1

PDB Entry: 3qkf (more details), 1.45 Å

PDB Description: Crystal structure of the mutant P317A of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with Mg and D-Gluconate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qkfc1 d.54.1.0 (C:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3qkfc1:

Click to download the PDB-style file with coordinates for d3qkfc1.
(The format of our PDB-style files is described here.)

Timeline for d3qkfc1: