SCOP 1.65: Domain d1ddob1: 1ddo B:1-194,B:288-339

Lineage for d1ddob1 (1ddo B:1-194,B:288-339)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
   This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold

6. Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)

8. Domain d1ddob1: 1ddo B:1-194,B:288-339 [30632]
   Other proteins in same PDB: d1ddoa2, d1ddob2, d1ddoc2, d1ddod2, d1ddoe2, d1ddof2, d1ddog2, d1ddoh2

Details for d1ddob1

PDB Entry: 1ddo, 3.1 Å

PDB Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp

SCOP Domain Sequences for d1ddob1:

Sequence; same for both SEQRES and ATOM records:

>d1ddob1 c.4.1.2 (B:1-194,B:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

Timeline for d1ddob1:

• d1ddob1 first appeared (with stable ids) in SCOP 1.55
  
• d1ddob1 appears in SCOP 1.63
  
• d1ddob1 appears in SCOP 1.67
  
• d1ddob1 appears in the current release, SCOPe 2.08