SCOPe 2.08: Domain d3pz8e1: 3pz8 E:3-84

Lineage for d3pz8e1 (3pz8 E:3-84)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d3pz8e1: 3pz8 E:3-84 [306274]
   Other proteins in same PDB: d3pz8b2, d3pz8d2, d3pz8e2, d3pz8f2
   automated match to d4wipc_
   mutant

Details for d3pz8e1

PDB Entry: 3pz8, 2.87 Å

PDB Description: Crystal structure of Dvl1-DIX(Y17D) mutant

PDB Compounds: (E:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d3pz8e1:

Sequence; same for both SEQRES and ATOM records:

>d3pz8e1 d.15.1.0 (E:3-84) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkee
ifddnaklpcfngrvvswlvla

Timeline for d3pz8e1:

• d3pz8e1 first appeared in SCOPe 2.06
  
• d3pz8e1 appears in SCOPe 2.07