Lineage for d3peza2 (3pez A:287-482)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)
  8. 2871700Domain d3peza2: 3pez A:287-482 [306235]
    Other proteins in same PDB: d3pezc1, d3pezc2
    automated match to d3peya2
    complexed with adp, ihp, mg

Details for d3peza2

PDB Entry: 3pez (more details), 2.9 Å

PDB Description: S. cerevisiae Dbp5 L327V bound to Nup159, Gle1 H337R, IP6 and ADP
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3peza2:

Sequence, based on SEQRES records: (download)

>d3peza2 c.37.1.0 (A:287-482) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pnantlelqtnevnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvl
ygklkseghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnyd
lptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvpt
ddwdevekivkkvlkd

Sequence, based on observed residues (ATOM records): (download)

>d3peza2 c.37.1.0 (A:287-482) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pnantlelvnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygkl
kseghevsilhgdlqtqerdrliddfregrskvlittndiptvsmvvnydlptlangqad
patyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekiv
kkvlkd

SCOPe Domain Coordinates for d3peza2:

Click to download the PDB-style file with coordinates for d3peza2.
(The format of our PDB-style files is described here.)

Timeline for d3peza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3peza1