Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries) |
Domain d3p3md3: 3p3m D:321-415 [306217] Other proteins in same PDB: d3p3ma1, d3p3ma2, d3p3mb1, d3p3mb2, d3p3mc1, d3p3mc2, d3p3md1, d3p3md2, d3p3me1, d3p3me2, d3p3mf1, d3p3mf2 automated match to d4m53a3 complexed with gtp |
PDB Entry: 3p3m (more details), 2.8 Å
SCOPe Domain Sequences for d3p3md3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p3md3 b.44.1.0 (D:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d3p3md3: