Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255782] (6 PDB entries) |
Domain d3p3md2: 3p3m D:207-320 [306216] Other proteins in same PDB: d3p3ma1, d3p3ma3, d3p3mb1, d3p3mb3, d3p3mc1, d3p3mc3, d3p3md1, d3p3md3, d3p3me1, d3p3me3, d3p3mf1, d3p3mf3 automated match to d4m53a2 complexed with gtp |
PDB Entry: 3p3m (more details), 2.8 Å
SCOPe Domain Sequences for d3p3md2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p3md2 b.43.3.0 (D:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d3p3md2: