Lineage for d3p3mc2 (3p3m C:207-320)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793403Species Sulfolobus solfataricus [TaxId:2287] [255782] (6 PDB entries)
  8. 2793411Domain d3p3mc2: 3p3m C:207-320 [306213]
    Other proteins in same PDB: d3p3ma1, d3p3ma3, d3p3mb1, d3p3mb3, d3p3mc1, d3p3mc3, d3p3md1, d3p3md3, d3p3me1, d3p3me3, d3p3mf1, d3p3mf3
    automated match to d4m53a2
    complexed with gtp

Details for d3p3mc2

PDB Entry: 3p3m (more details), 2.8 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus complexed with GTP
PDB Compounds: (C:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3p3mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3mc2 b.43.3.0 (C:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d3p3mc2:

Click to download the PDB-style file with coordinates for d3p3mc2.
(The format of our PDB-style files is described here.)

Timeline for d3p3mc2: