Lineage for d1h7xc4 (1h7x C:184-287,C:441-532)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458575Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2458576Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2458577Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2458590Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 2458591Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries)
  8. 2458602Domain d1h7xc4: 1h7x C:184-287,C:441-532 [30615]
    Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa3, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb3, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd3, d1h7xd5
    complexed with fad, fmn, ndp, sf4, urf; mutant

Details for d1h7xc4

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil
PDB Compounds: (C:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7xc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xc4 c.4.1.1 (C:184-287,C:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d1h7xc4:

Click to download the PDB-style file with coordinates for d1h7xc4.
(The format of our PDB-style files is described here.)

Timeline for d1h7xc4: