Lineage for d1h7xa4 (1h7x A:184-287,A:441-532)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119416Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 119417Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
  5. 119418Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins)
  6. 119428Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 119429Species Pig (Sus scrofa) [TaxId:9823] [51978] (2 PDB entries)
  8. 119434Domain d1h7xa4: 1h7x A:184-287,A:441-532 [30613]
    Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa3, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb3, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd3, d1h7xd5

Details for d1h7xa4

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil

SCOP Domain Sequences for d1h7xa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xa4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOP Domain Coordinates for d1h7xa4:

Click to download the PDB-style file with coordinates for d1h7xa4.
(The format of our PDB-style files is described here.)

Timeline for d1h7xa4: