Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries) |
Domain d3o8kb1: 3o8k B:1007-1140 [306104] automated match to d1dfca1 complexed with o8k |
PDB Entry: 3o8k (more details), 2.7 Å
SCOPe Domain Sequences for d3o8kb1:
Sequence, based on SEQRES records: (download)
>d3o8kb1 b.42.5.1 (B:1007-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} aeavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdeagsaavclrshl grylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtv spaekwsvhiamhp
>d3o8kb1 b.42.5.1 (B:1007-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} aeavqiqfglincgnkyltafkvnasasslkkkqiwtaavclshlgrylaadkdgnvtce revpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvspaekwsvhiamhp
Timeline for d3o8kb1:
View in 3D Domains from other chains: (mouse over for more information) d3o8ka1, d3o8ka2, d3o8ka3, d3o8ka4 |