Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Escherichia coli [TaxId:562] [270946] (4 PDB entries) |
Domain d3o7zd1: 3o7z D:117-226 [306097] Other proteins in same PDB: d3o7za2, d3o7za3, d3o7zb2, d3o7zb3, d3o7zc2, d3o7zc3, d3o7zd2, d3o7zd3 automated match to d1m7xa1 complexed with glc, gol |
PDB Entry: 3o7z (more details), 2.55 Å
SCOPe Domain Sequences for d3o7zd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o7zd1 b.1.18.0 (D:117-226) automated matches {Escherichia coli [TaxId: 562]} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
Timeline for d3o7zd1: