Lineage for d3nsrb_ (3nsr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888372Species Salmonella enterica [TaxId:54388] [311321] (1 PDB entry)
  8. 2888374Domain d3nsrb_: 3nsr B: [306057]
    automated match to d1ryza_
    complexed with azi, edo, gol, k, peg, pg4, urf

Details for d3nsrb_

PDB Entry: 3nsr (more details), 2.2 Å

PDB Description: X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with 5-Fluorouracil at 2.2 A Resolution
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d3nsrb_:

Sequence, based on SEQRES records: (download)

>d3nsrb_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella enterica [TaxId: 54388]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d3nsrb_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella enterica [TaxId: 54388]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetkqteshavki
vveaarrll

SCOPe Domain Coordinates for d3nsrb_:

Click to download the PDB-style file with coordinates for d3nsrb_.
(The format of our PDB-style files is described here.)

Timeline for d3nsrb_: