Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Uridine phosphorylase [53176] (6 species) |
Species Salmonella enterica [TaxId:54388] [311321] (1 PDB entry) |
Domain d3nsrb_: 3nsr B: [306057] automated match to d1ryza_ complexed with azi, edo, gol, k, peg, pg4, urf |
PDB Entry: 3nsr (more details), 2.2 Å
SCOPe Domain Sequences for d3nsrb_:
Sequence, based on SEQRES records: (download)
>d3nsrb_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella enterica [TaxId: 54388]} sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk ivveaarrll
>d3nsrb_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella enterica [TaxId: 54388]} sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetkqteshavki vveaarrll
Timeline for d3nsrb_: