Lineage for d3nnib_ (3nni B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818685Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2818686Protein automated matches [226914] (2 species)
    not a true protein
  7. 2818687Species Human (Homo sapiens) [TaxId:9606] [225158] (28 PDB entries)
  8. 2818744Domain d3nnib_: 3nni B: [306053]
    automated match to d3k5ka_
    complexed with ciq, sah, unx, zn

Details for d3nnib_

PDB Entry: 3nni (more details), 2.56 Å

PDB Description: Crystal structure of histone lysine methyltransferase G9A with an inhibitor
PDB Compounds: (B:) HLA-B associated transcript 8 BAT8 isoform a variant

SCOPe Domain Sequences for d3nnib_:

Sequence, based on SEQRES records: (download)

>d3nnib_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqsrla

Sequence, based on observed residues (ATOM records): (download)

>d3nnib_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnevycidary
ygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdiks
kyftcqcgsekckhsaeaialeqsrla

SCOPe Domain Coordinates for d3nnib_:

Click to download the PDB-style file with coordinates for d3nnib_.
(The format of our PDB-style files is described here.)

Timeline for d3nnib_: