Lineage for d3ndyb_ (3ndy B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095410Species Clostridium cellulovorans [TaxId:1493] [311320] (2 PDB entries)
  8. 2095416Domain d3ndyb_: 3ndy B: [306032]
    automated match to d4im4a_
    complexed with btb

Details for d3ndyb_

PDB Entry: 3ndy (more details), 2.1 Å

PDB Description: The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans
PDB Compounds: (B:) Endoglucanase D

SCOPe Domain Sequences for d3ndyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndyb_ c.1.8.0 (B:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss

SCOPe Domain Coordinates for d3ndyb_:

Click to download the PDB-style file with coordinates for d3ndyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ndyb_: