Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins) |
Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (3 PDB entries) |
Domain d2tmdb3: 2tmd B:341-489,B:646-729 [30603] Other proteins in same PDB: d2tmda1, d2tmda2, d2tmdb1, d2tmdb2 |
PDB Entry: 2tmd (more details), 2.4 Å
SCOP Domain Sequences for d2tmdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tmdb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1} dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv
Timeline for d2tmdb3: